<entry id="STF0001" title="Bovine acyl-coenzyme A binding protein (ACBP)">
  
  <protein name="Acyl-CoA-binding protein" organism="Bos taurus" number_of_residues="86" uniprot_id="P07107" uniprot_range="2-87" pdb_id="2abd">
    
    <experiment id="1">
      <method type="folding">Quenched-flow HDX NMR</method>
      <conditions pH="5.3 - 5.3" temperature="5.0" probes="82">None</conditions>
      <protection protection_level="EARLY">protection rate (s-1) ~20±5</protection>
      <sequence is_pdb="True">SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI</sequence>
      <details>The time dependence of hydrogen exchange protection in the refolding of ACBP has been followed in 20 mM sodium acetate, 0.54 M GuHCl at pH 5.3 and 278 K. A total of 17 samples were prepared for a set of refolding times ranging from 0 ms to 250 ms.</details>
      
        
        <residue index="8" code="A"></residue>
        
      
        
        <residue index="9" code="A"></residue>
        
      
        
        <residue index="10" code="E"></residue>
        
      
        
        <residue index="11" code="E"></residue>
        
      
        
        <residue index="12" code="V"></residue>
        
      
        
        <residue index="28" code="Y"></residue>
        
      
        
        <residue index="29" code="S"></residue>
        
      
        
        <residue index="31" code="Y"></residue>
        
      
        
        <residue index="32" code="K"></residue>
        
      
        
        <residue index="34" code="A"></residue>
        
      
        
        <residue index="35" code="T"></residue>
        
      
        
        <residue index="36" code="V"></residue>
        
      
        
        <residue index="37" code="G"></residue>
        
      
        
        <residue index="39" code="I"></residue>
        
      
        
        <residue index="55" code="W"></residue>
        
      
        
        <residue index="56" code="D"></residue>
        
      
        
        <residue index="57" code="A"></residue>
        
      
        
        <residue index="58" code="W"></residue>
        
      
        
        <residue index="59" code="N"></residue>
        
      
        
        <residue index="60" code="E"></residue>
        
      
        
        <residue index="61" code="L"></residue>
        
      
        
        <residue index="62" code="K"></residue>
        
      
        
        <residue index="64" code="T"></residue>
        
      
        
        <residue index="69" code="A"></residue>
        
      
        
        <residue index="70" code="M"></residue>
        
      
        
        <residue index="71" code="K"></residue>
        
      
        
        <residue index="72" code="A"></residue>
        
      
        
        <residue index="73" code="Y"></residue>
        
      
        
        <residue index="74" code="I"></residue>
        
      
        
        <residue index="75" code="D"></residue>
        
      
        
        <residue index="76" code="K"></residue>
        
      
        
        <residue index="77" code="V"></residue>
        
      
        
        <residue index="78" code="E"></residue>
        
      
        
        <residue index="79" code="E"></residue>
        
      
        
        <residue index="80" code="L"></residue>
        
      
        
        <residue index="81" code="K"></residue>
        
      
        
        <residue index="82" code="K"></residue>
        
      
        
        <residue index="83" code="K"></residue>
        
      
        
        <residue index="84" code="Y"></residue>
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
    </experiment>
    
    <experiment id="2">
      <method type="folding">Quenched-flow HDX NMR</method>
      <conditions pH="5.3 - 5.3" temperature="5.0" probes="82">None</conditions>
      <protection protection_level="EARLY">Burst phase amplitude &gt; 0.30</protection>
      <sequence is_pdb="True">SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI</sequence>
      <details>The time dependence of hydrogen exchange protection in the refolding of ACBP has been followed in 20 mM sodium acetate, 0.54 M GuHCl at pH 5.3 and 278 K. A total of 17 samples were prepared for a set of refolding times ranging from 0 ms to 250 ms.</details>
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
        <residue index="9" code="A"></residue>
        
      
        
        <residue index="11" code="E"></residue>
        
      
        
        <residue index="12" code="V"></residue>
        
      
        
        <residue index="61" code="L"></residue>
        
      
        
        <residue index="62" code="K"></residue>
        
      
        
        <residue index="71" code="K"></residue>
        
      
        
        <residue index="74" code="I"></residue>
        
      
        
        <residue index="75" code="D"></residue>
        
      
        
        <residue index="77" code="V"></residue>
        
      
        
        <residue index="81" code="K"></residue>
        
      
        
        <residue index="83" code="K"></residue>
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
    </experiment>
    
    <experiment id="3">
      <method type="folding">Quenched-flow HDX NMR</method>
      <conditions pH="5.3 - 5.3" temperature="5.0" probes="82">None</conditions>
      <protection protection_level="INTERMEDIATE">0.20 &lt; Burst phase amplitude &lt; 0.30</protection>
      <sequence is_pdb="True">SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI</sequence>
      <details>The time dependence of hydrogen exchange protection in the refolding of ACBP has been followed in 20 mM sodium acetate, 0.54 M GuHCl at pH 5.3 and 278 K. A total of 17 samples were prepared for a set of refolding times ranging from 0 ms to 250 ms.</details>
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
        <residue index="8" code="A"></residue>
        
      
        
        <residue index="10" code="E"></residue>
        
      
        
        <residue index="36" code="V"></residue>
        
      
        
        <residue index="57" code="A"></residue>
        
      
        
        <residue index="73" code="Y"></residue>
        
      
        
        <residue index="76" code="K"></residue>
        
      
        
        <residue index="78" code="E"></residue>
        
      
        
        <residue index="79" code="E"></residue>
        
      
        
        <residue index="80" code="L"></residue>
        
      
        
        <residue index="82" code="K"></residue>
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
    </experiment>
    
    <experiment id="4">
      <method type="folding">Quenched-flow HDX NMR</method>
      <conditions pH="5.3 - 5.3" temperature="5.0" probes="82">None</conditions>
      <protection protection_level="LATE">0.10 &lt; Burst phase amplitude &lt; 0.20</protection>
      <sequence is_pdb="True">SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI</sequence>
      <details>The time dependence of hydrogen exchange protection in the refolding of ACBP has been followed in 20 mM sodium acetate, 0.54 M GuHCl at pH 5.3 and 278 K. A total of 17 samples were prepared for a set of refolding times ranging from 0 ms to 250 ms.</details>
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
        <residue index="28" code="Y"></residue>
        
      
        
        <residue index="32" code="K"></residue>
        
      
        
        <residue index="34" code="A"></residue>
        
      
        
        <residue index="35" code="T"></residue>
        
      
        
        <residue index="37" code="G"></residue>
        
      
        
        <residue index="55" code="W"></residue>
        
      
        
        <residue index="58" code="W"></residue>
        
      
        
        <residue index="60" code="E"></residue>
        
      
        
        <residue index="70" code="M"></residue>
        
      
        
        <residue index="84" code="Y"></residue>
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
    </experiment>
    
    <experiment id="5">
      <method type="stability">Native exchange NMR</method>
      <conditions pH="6.65 - 6.65" temperature="25.0" probes="43">None</conditions>
      <protection protection_level="STRONG">log(P) &gt; 4</protection>
      <sequence is_pdb="True">SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI</sequence>
      <details>Amide hydrogen exchange with solvent deuterium was performed in deuterium oxide at pH 6.65. A sample of 2 mM free ACBP in H2O was adjusted to the desired pH and lyophilized repeatedly. After a final lyophilization the protein was dissolved in 600 ml 99.99% D2O and transferred to a precooled NMR tube. The protein-ligand sample was dissolved in 600 ml of D2O and 0.04 M potassium phosphate (pH 6.65) to concentrations of 2 mM. Potassium phosphate was deuterated by repeated lyophilization from D2O, redissolved in 99.99% D2O and quickly transferred to the lyophilized protein-ligand complex. After transfer to a precooled NMR tube the sample was immediately placed in the spectrometer which in advance had been tuned and calibrated on a similar sample.</details>
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
        <residue index="29" code="S"></residue>
        
      
        
        <residue index="30" code="H"></residue>
        
      
        
        <residue index="31" code="Y"></residue>
        
      
        
        <residue index="32" code="K"></residue>
        
      
        
        <residue index="34" code="A"></residue>
        
      
        
        <residue index="35" code="T"></residue>
        
      
        
        <residue index="37" code="G"></residue>
        
      
        
        <residue index="39" code="I"></residue>
        
      
        
        <residue index="56" code="D"></residue>
        
      
        
        <residue index="57" code="A"></residue>
        
      
        
        <residue index="58" code="W"></residue>
        
      
        
        <residue index="59" code="N"></residue>
        
      
        
        <residue index="60" code="E"></residue>
        
      
        
        <residue index="61" code="L"></residue>
        
      
        
        <residue index="62" code="K"></residue>
        
      
        
        <residue index="64" code="T"></residue>
        
      
        
        <residue index="70" code="M"></residue>
        
      
        
        <residue index="72" code="A"></residue>
        
      
        
        <residue index="73" code="Y"></residue>
        
      
        
        <residue index="74" code="I"></residue>
        
      
        
        <residue index="76" code="K"></residue>
        
      
        
        <residue index="77" code="V"></residue>
        
      
        
        <residue index="78" code="E"></residue>
        
      
        
        <residue index="79" code="E"></residue>
        
      
        
        <residue index="80" code="L"></residue>
        
      
        
        <residue index="81" code="K"></residue>
        
      
        
        <residue index="82" code="K"></residue>
        
      
        
        <residue index="83" code="K"></residue>
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
    </experiment>
    
    <experiment id="6">
      <method type="stability">Native exchange NMR</method>
      <conditions pH="6.65 - 6.65" temperature="25.0" probes="43">None</conditions>
      <protection protection_level="MEDIUM">2 &lt; log(P) &lt; 4</protection>
      <sequence is_pdb="True">SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI</sequence>
      <details>Amide hydrogen exchange with solvent deuterium was performed in deuterium oxide at pH 6.65. A sample of 2 mM free ACBP in H2O was adjusted to the desired pH and lyophilized repeatedly. After a final lyophilization the protein was dissolved in 600 ml 99.99% D2O and transferred to a precooled NMR tube. The protein-ligand sample was dissolved in 600 ml of D2O and 0.04 M potassium phosphate (pH 6.65) to concentrations of 2 mM. Potassium phosphate was deuterated by repeated lyophilization from D2O, redissolved in 99.99% D2O and quickly transferred to the lyophilized protein-ligand complex. After transfer to a precooled NMR tube the sample was immediately placed in the spectrometer which in advance had been tuned and calibrated on a similar sample.</details>
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
        <residue index="8" code="A"></residue>
        
      
        
        <residue index="9" code="A"></residue>
        
      
        
        <residue index="10" code="E"></residue>
        
      
        
        <residue index="11" code="E"></residue>
        
      
        
        <residue index="12" code="V"></residue>
        
      
        
        <residue index="13" code="K"></residue>
        
      
        
        <residue index="24" code="M"></residue>
        
      
        
        <residue index="38" code="D"></residue>
        
      
        
        <residue index="55" code="W"></residue>
        
      
        
        <residue index="63" code="G"></residue>
        
      
        
        <residue index="84" code="Y"></residue>
        
      
        
        <residue index="85" code="G"></residue>
        
      
    </experiment>
    
  </protein>
  
</entry>
